PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do029755.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family NAC
Protein Properties Length: 312aa    MW: 33602.2 Da    PI: 5.8466
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do029755.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM68.51.9e-21241528126
         NAM   8 hPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk.....kvkaeekewyfFskrdkkyatgkrknratk..sgyWkatgkdkevlsk 95 
                 hP++eel++ +L+++v ++      ++  +i+++d+y+++P dL +      +++++  wyfFs  + k++ g+rk r+++  +g W++    k+v+++
  Do029755.1  24 HPSEEELITSFLRPRVLADYagggAPC-AFIHDADVYSADPDDLTRafgpaLASNGDAAWYFFSVVRAKTRDGQRKARTVEsgEGCWHSEAGAKPVVDE 121
                 9**************998886665666.68**************84477765556888********************87644788************* PP

         NAM  96 kgelvglkktLvfykgrapkgektdWvmhey 126
                  g+  g ++++ f ++ + + +++ W+m e 
  Do029755.1 122 AGRCLGHRQSFSFVTKVDGRRVRSGWLMVEL 152
                 **************99999999******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100526.79817168IPR003441NAC domain
PfamPF023655.1E-1224152IPR003441NAC domain
SuperFamilySSF1019416.8E-3124168IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MVVATRCRKA PGPTSPRAAD LAAHPSEEEL ITSFLRPRVL ADYAGGGAPC AFIHDADVYS  60
ADPDDLTRAF GPALASNGDA AWYFFSVVRA KTRDGQRKAR TVESGEGCWH SEAGAKPVVD  120
EAGRCLGHRQ SFSFVTKVDG RRVRSGWLMV ELGLDDADDV ALCKVYFSPR ARHGAGGPSA  180
AGRKRKAAAA ADDRNPASPR QRRRARPTEA SASHDDDDVT ADGAEVEQST QGGSGVVAGE  240
STAGGDSDEE LWTGGSFFSW WMRNRDRLLV EYGIVDRSDE ELLKTLGLDV LMKDLTYDLH  300
RHSHGGIDCV NP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-112416622166Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193202RNPASPRQRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458311.14e-99hypothetical protein SORBIDRAFT_03g031000
TrEMBLK3XS061e-111K3XS06_SETIT; Uncharacterized protein
STRINGSi004703m1e-110(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40112972
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.11e-15NAC domain containing protein 35